ATP6V1A Antikörper (N-Term)

Produktnummer ABIN631586

Produktdetails anti-ATP6V1A Antikörper

Target: ATP6V1A (ATPase, H+ Transporting, Lysosomal 70kDa, V1 Subunit A (ATP6V1A))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ATP6V1A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ATP6 V6 antibody was raised against the N terminal of ATP6 6

Aufreinigung: Affinity purified

Immunogen: ATP6 V6 antibody was raised using the N terminal of ATP6 6 corresponding to a region with amino acids SGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQTQSIYIPR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ATP6V1A Blocking Peptide, catalog no. 33R-8503, is also available for use as a blocking control in assays to test for specificity of this ATP6V1A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ATP6V1A

Target: ATP6V1A (ATPase, H+ Transporting, Lysosomal 70kDa, V1 Subunit A (ATP6V1A))

Andere Bezeichnung: ATP6V1A (ATP6V1A Produkte)

Synonyme: ATP6A1 antikoerper, ATP6V1A1 antikoerper, HO68 antikoerper, VA68 antikoerper, VPP2 antikoerper, Vma1 antikoerper, AI647066 antikoerper, Atp6a1 antikoerper, Atp6a2 antikoerper, Atp6v1a1 antikoerper, ATP6V1A antikoerper, atp6v1al antikoerper, zgc:63516 antikoerper, An02g10440 antikoerper, AO090102000349 antikoerper, vacuolar ATP synthase subunit A antikoerper, atp6a1 antikoerper, atp6v1a1 antikoerper, ho68 antikoerper, v1a antikoerper, va68 antikoerper, vma1 antikoerper, vpp2 antikoerper, CG12403 antikoerper, Dmel\CG12403 antikoerper, V-ATPase antikoerper, Vha antikoerper, Vha-68-1 antikoerper, Vha68 antikoerper, vha67-2 antikoerper, vha68-1 antikoerper, ATPase H+ transporting V1 subunit A antikoerper, ATPase, H+ transporting, lysosomal V1 subunit A antikoerper, ATPase, H+ transporting, lysosomal, V1 subunit Aa antikoerper, v-type proton ATPase catalytic subunit A antikoerper, vacuolar ATP synthase subunit A antikoerper, ATPase H+ transporting V1 subunit A L homeolog antikoerper, vacuolar proton pump 3 antikoerper, Vacuolar H[+] ATPase 68kD subunit 1 antikoerper, ATP6V1A antikoerper, Atp6v1a antikoerper, atp6v1aa antikoerper, ANI_1_1468024 antikoerper, AOR_1_602134 antikoerper, VHA-A antikoerper, atp6v1a.L antikoerper, vpp3 antikoerper, Vha68-1 antikoerper

Hintergrund: This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles.

Molekulargewicht: 68 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis, Proton Transport, SARS-CoV-2 Protein Interaktom