GOPC Antikörper (Middle Region)
-
- Target Alle GOPC Antikörper anzeigen
- GOPC (Golgi-Associated PDZ and Coiled-Coil Motif Containing (GOPC))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GOPC Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GOPC antibody was raised against the middle region of GOPC
- Aufreinigung
- Affinity purified
- Immunogen
- GOPC antibody was raised using the middle region of GOPC corresponding to a region with amino acids RNDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGLGISITGGKE
- Top Product
- Discover our top product GOPC Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GOPC Blocking Peptide, catalog no. 33R-8073, is also available for use as a blocking control in assays to test for specificity of this GOPC antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GOPC antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GOPC (Golgi-Associated PDZ and Coiled-Coil Motif Containing (GOPC))
- Andere Bezeichnung
- GOPC (GOPC Produkte)
- Synonyme
- DKFZp459H2130 antikoerper, 2210402P09Rik antikoerper, AI844555 antikoerper, CAL antikoerper, FIG antikoerper, GOPC1 antikoerper, PIST antikoerper, fe38f01 antikoerper, wu:fe38f01 antikoerper, zgc:56254 antikoerper, zgc:65853 antikoerper, dJ94G16.2 antikoerper, cal antikoerper, gopc1 antikoerper, pist antikoerper, golgi associated PDZ and coiled-coil motif containing antikoerper, golgi-associated PDZ and coiled-coil motif containing antikoerper, golgi-associated PDZ and coiled-coil motif containing S homeolog antikoerper, GOPC antikoerper, Gopc antikoerper, gopc antikoerper, gopc.S antikoerper
- Hintergrund
- GOPC plays a role in intracellular protein trafficking and degradation. GOPC may regulate CFTR chloride currents and acid-induced ACCN3 currents by modulating cell surface expression of both channels. GOPC may also regulate the intracellular trafficking of the ADR1B receptor. GOPC may play a role in autophagy.
- Molekulargewicht
- 50 kDa (MW of target protein)
- Pathways
- Maintenance of Protein Location, Asymmetric Protein Localization
-