GSTa5 Antikörper (Middle Region)
-
- Target Alle GSTa5 Antikörper anzeigen
- GSTa5 (Glutathione S-Transferase alpha 5 (GSTa5))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GSTa5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GSTA5 antibody was raised against the middle region of GSTA5
- Aufreinigung
- Affinity purified
- Immunogen
- GSTA5 antibody was raised using the middle region of GSTA5 corresponding to a region with amino acids QPEERDAKTALVKEKIKNRYFPAFEKVLKSHRQDYLVGNKLSWADIHLVE
- Top Product
- Discover our top product GSTa5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GSTA5 Blocking Peptide, catalog no. 33R-7675, is also available for use as a blocking control in assays to test for specificity of this GSTA5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSTA5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GSTa5 (Glutathione S-Transferase alpha 5 (GSTa5))
- Andere Bezeichnung
- GSTA5 (GSTa5 Produkte)
- Synonyme
- Gsta2 antikoerper, Yc2 antikoerper, glutathione S-transferase alpha 5 antikoerper, glutathione S-transferase alpha 3 antikoerper, GSTA5 antikoerper, Gsta5 antikoerper, Gsta3 antikoerper
- Hintergrund
- GSTA5 belongs to the GST superfamily, alpha family. It contains 1 GST C-terminal domain and 1 GST N-terminal domain. The exact functions of GSTA5 remain unknown.
- Molekulargewicht
- 26 kDa (MW of target protein)
-