METTL7B Antikörper (Middle Region)

Produktnummer ABIN631547

Produktdetails anti-METTL7B Antikörper

Target: METTL7B (Methyltransferase Like 7B (METTL7B))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser METTL7B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: METTL7 B antibody was raised against the middle region of METTL7

Aufreinigung: Affinity purified

Immunogen: METTL7 B antibody was raised using the middle region of METTL7 corresponding to a region with amino acids FVVAPGEDMRQLADGSMDVVVCTLVLCSVQSPRKVLQEVRRVLRPGGVLF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

METTL7B Blocking Peptide, catalog no. 33R-3123, is also available for use as a blocking control in assays to test for specificity of this METTL7B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of METTL0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu METTL7B

Target: METTL7B (Methyltransferase Like 7B (METTL7B))

Andere Bezeichnung: METTL7B (METTL7B Produkte)

Synonyme: ALDI antikoerper, 0610006F02Rik antikoerper, AI266817 antikoerper, RGD1305205 antikoerper, methyltransferase like 7B antikoerper, METTL7B antikoerper, Mettl7b antikoerper

Hintergrund: METTL7B belongs to the methyltransferase superfamily. It is a probable methyltransferase.

Molekulargewicht: 22 kDa (MW of target protein)