TIGD3 Antikörper (Middle Region)
-
- Target Alle TIGD3 Antikörper anzeigen
- TIGD3 (Tigger Transposable Element Derived 3 (TIGD3))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TIGD3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TIGD3 antibody was raised against the middle region of TIGD3
- Aufreinigung
- Affinity purified
- Immunogen
- TIGD3 antibody was raised using the middle region of TIGD3 corresponding to a region with amino acids FVDLEGEEPRSGVCKEEIGTEDEKGDREGAFEPLPTKADALRALGTLRRW
- Top Product
- Discover our top product TIGD3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TIGD3 Blocking Peptide, catalog no. 33R-3110, is also available for use as a blocking control in assays to test for specificity of this TIGD3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TIGD3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TIGD3 (Tigger Transposable Element Derived 3 (TIGD3))
- Andere Bezeichnung
- TIGD3 (TIGD3 Produkte)
- Synonyme
- tigger transposable element derived 3 antikoerper, TIGD3 antikoerper, Tigd3 antikoerper
- Hintergrund
- TIGD3 belongs to the tigger subfamily of the pogo superfamily of DNA-mediated transposons in humans. These proteins are related to DNA transposons found in fungi and nematodes, and more distantly to the Tc1 and mariner transposases. They are also very similar to the major mammalian centromere protein B. The exact function of TIGD3 gene is not known.
- Molekulargewicht
- 52 kDa (MW of target protein)
-