GPT2 Antikörper

Produktnummer ABIN631541

Produktdetails anti-GPT2 Antikörper

Target: GPT2 (Glutamic Pyruvate Transaminase (Alanine Aminotransferase) 2 (GPT2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GPT2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: GPT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPVAGEESFEQFSREKESVLG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GPT2 Blocking Peptide, catalog no. 33R-2475, is also available for use as a blocking control in assays to test for specificity of this GPT2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPT2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GPT2

Target: GPT2 (Glutamic Pyruvate Transaminase (Alanine Aminotransferase) 2 (GPT2))

Andere Bezeichnung: GPT2 (GPT2 Produkte)

Synonyme: ALT2 antikoerper, GPT2 antikoerper, im:7150662 antikoerper, sb:cb580 antikoerper, zgc:165657 antikoerper, Cc2-5 antikoerper, 4631422C05Rik antikoerper, AU014768 antikoerper, AU041193 antikoerper, C87201 antikoerper, ALANINE AMINOTRANSFERASE 2 antikoerper, AtAlaAT2 antikoerper, AtAlaATm antikoerper, T10D10.20 antikoerper, T10D10_20 antikoerper, alanine aminotransferase 2 antikoerper, glutamic--pyruvic transaminase 2 antikoerper, glutamic pyruvate transaminase (alanine aminotransferase) 2 L homeolog antikoerper, glutamic pyruvate transaminase (alanine aminotransferase) 2 antikoerper, alanine aminotransferase 2 antikoerper, GPT2 antikoerper, gpt2.L antikoerper, gpt2 antikoerper, PTRG_06494 antikoerper, Gpt2 antikoerper, ALAAT2 antikoerper

Hintergrund: GPT and GPT2, also known as alanine transaminases, are pyridoxal enzymes that catalyze the reversible transamination between alanine and 2-oxoglutarate to form pyruvate and glutamate. By mediating the conversion of these 4 major intermediate metabolites, these transaminases have roles in gluconeogenesis and in amino acid metabolism.GPT and GPT2, also known as alanine transaminases, are pyridoxal enzymes that catalyze the reversible transamination between alanine and 2-oxoglutarate to form pyruvate and glutamate.

Molekulargewicht: 58 kDa (MW of target protein)