RABGGTB Antikörper (Middle Region)
-
- Target Alle RABGGTB Antikörper anzeigen
- RABGGTB (Rab Geranylgeranyltransferase, beta Subunit (RABGGTB))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RABGGTB Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RABGGTB antibody was raised against the middle region of RABGGTB
- Aufreinigung
- Affinity purified
- Immunogen
- RABGGTB antibody was raised using the middle region of RABGGTB corresponding to a region with amino acids PGDMVDPFHTLFGIAGLSLLGEEQIKPVNPVFCMPEEVLQRVNVQPELVS
- Top Product
- Discover our top product RABGGTB Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RABGGTB Blocking Peptide, catalog no. 33R-7095, is also available for use as a blocking control in assays to test for specificity of this RABGGTB antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RABGGTB antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RABGGTB (Rab Geranylgeranyltransferase, beta Subunit (RABGGTB))
- Andere Bezeichnung
- RABGGTB (RABGGTB Produkte)
- Synonyme
- RABGGTB antikoerper, wu:fj12b07 antikoerper, zgc:56443 antikoerper, GGTB antikoerper, Rab geranylgeranyltransferase beta subunit antikoerper, Rab geranylgeranyltransferase, beta subunit antikoerper, Rab geranylgeranyl transferase, b subunit antikoerper, Rab geranylgeranyltransferase, beta subunit S homeolog antikoerper, RABGGTB antikoerper, AFUA_7G04460 antikoerper, NFIA_025430 antikoerper, ACLA_006160 antikoerper, PMAA_088560 antikoerper, AFLA_073740 antikoerper, TSTA_124030 antikoerper, TRV_03221 antikoerper, rabggtb antikoerper, Rabggtb antikoerper, rabggtb.S antikoerper
- Hintergrund
- RABGGTB catalyzes the transfer of a geranyl-geranyl moiety from geranyl-geranyl pyrophosphate to both cysteines in Rab proteins with an -XXCC, -XCXC and -CCXX C-terminal, such as RAB1A, RAB3A and RAB5A respectively.
- Molekulargewicht
- 37 kDa (MW of target protein)
-