RABGGTB Antikörper (Middle Region)

Produktnummer ABIN631532

Der Kaninchen Polyklonal anti-RABGGTB Antikörper wird verwendet zum Nachweis von RABGGTB in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für RABGGTB Antikörper (Middle Region) (ABIN631532)

Target: RABGGTB (Rab Geranylgeranyltransferase, beta Subunit (RABGGTB))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RABGGTB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RABGGTB Antikörper

Bindungsspezifität: Middle Region

Spezifität: RABGGTB antibody was raised against the middle region of RABGGTB

Aufreinigung: Affinity purified

Immunogen: RABGGTB antibody was raised using the middle region of RABGGTB corresponding to a region with amino acids PGDMVDPFHTLFGIAGLSLLGEEQIKPVNPVFCMPEEVLQRVNVQPELVS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RABGGTB Blocking Peptide, (ABIN5615723), is also available for use as a blocking control in assays to test for specificity of this RABGGTB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RABGGTB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RABGGTB

Target: RABGGTB (Rab Geranylgeranyltransferase, beta Subunit (RABGGTB))

Andere Bezeichnung: RABGGTB

Hintergrund: RABGGTB catalyzes the transfer of a geranyl-geranyl moiety from geranyl-geranyl pyrophosphate to both cysteines in Rab proteins with an -XXCC, -XCXC and -CCXX C-terminal, such as RAB1A, RAB3A and RAB5A respectively.

Molekulargewicht: 37 kDa (MW of target protein)