ME1 Antikörper

Produktnummer ABIN631513

Produktdetails anti-ME1 Antikörper

Target: ME1 (Malic Enzyme 1, NADP(+)-Dependent, Cytosolic (ME1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ME1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: ME1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QQLNIHGLLPPSFNSQEIQVLRVVKNFEHLNSDFDRYLLLMDLQDRNEKL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ME1 Blocking Peptide, catalog no. 33R-7695, is also available for use as a blocking control in assays to test for specificity of this ME1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ME1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ME1

Target: ME1 (Malic Enzyme 1, NADP(+)-Dependent, Cytosolic (ME1))

Andere Bezeichnung: ME1 (ME1 Produkte)

Synonyme: HUMNDME antikoerper, MES antikoerper, D9Ertd267e antikoerper, Mdh-1 antikoerper, Mod-1 antikoerper, Mod1 antikoerper, MOD1 antikoerper, ME1 antikoerper, zgc:153079 antikoerper, malic enzyme 1 antikoerper, malic enzyme 1, NADP(+)-dependent, cytosolic antikoerper, ME1 antikoerper, Me1 antikoerper, me1 antikoerper

Hintergrund: ME1 is a cytosolic, NADP-dependent enzyme that generates NADPH for fatty acid biosynthesis. The activity of this enzyme, the reversible oxidative decarboxylation of malate, links the glycolytic and citric acid cycles. The regulation of expression for this gene is complex. Increased expression can result from elevated levels of thyroid hormones or by higher proportions of carbohydrates in the diet.

Molekulargewicht: 64 kDa (MW of target protein)

Pathways: Regulation of Lipid Metabolism by PPARalpha