GSTA3 Antikörper (Middle Region)

Produktnummer ABIN631512

Produktdetails anti-GSTA3 Antikörper

Target: GSTA3 (Glutathione S-Transferase alpha 3 (GSTA3))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GSTA3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GSTA3 antibody was raised against the middle region of GSTA3

Aufreinigung: Affinity purified

Immunogen: GSTA3 antibody was raised using the middle region of GSTA3 corresponding to a region with amino acids SSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GSTA3 Blocking Peptide, catalog no. 33R-8822, is also available for use as a blocking control in assays to test for specificity of this GSTA3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSTA3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GSTA3

Target: GSTA3 (Glutathione S-Transferase alpha 3 (GSTA3))

Andere Bezeichnung: GSTA3 (GSTA3 Produkte)

Synonyme: GSTA3 antikoerper, GST antikoerper, GSTA1 antikoerper, GSTA3-3 antikoerper, GTA3 antikoerper, GSTA2 antikoerper, Gst2-3 antikoerper, Yc2 antikoerper, glutathione S-transferase alpha 3 antikoerper, glutathione S-transferase A2 antikoerper, glutathione S-transferase antikoerper, glutathione S-transferase, alpha 3 antikoerper, glutathione S-transferase Yc antikoerper, GSTA3 antikoerper, LOC474938 antikoerper, gsta3 antikoerper, Gsta3 antikoerper, LOC100328911 antikoerper

Hintergrund: Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta.

Molekulargewicht: 25 kDa (MW of target protein)