RPS13 Antikörper (Middle Region)
-
- Target Alle RPS13 Antikörper anzeigen
- RPS13 (Ribosomal Protein S13 (RPS13))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RPS13 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RPS13 antibody was raised against the middle region of RPS13
- Aufreinigung
- Affinity purified
- Immunogen
- RPS13 antibody was raised using the middle region of RPS13 corresponding to a region with amino acids ILRILKSKGLAPDLPEDLYHLIKKAVAVRKHLERNRKDKDAKFRLILIES
- Top Product
- Discover our top product RPS13 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RPS13 Blocking Peptide, catalog no. 33R-4059, is also available for use as a blocking control in assays to test for specificity of this RPS13 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS13 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RPS13 (Ribosomal Protein S13 (RPS13))
- Andere Bezeichnung
- RPS13 (RPS13 Produkte)
- Synonyme
- S13 antikoerper, 2700063M04Rik antikoerper, fb14f11 antikoerper, fd13f08 antikoerper, fd60g01 antikoerper, wu:fb14f11 antikoerper, wu:fd13f08 antikoerper, wu:fd60g01 antikoerper, zgc:91809 antikoerper, rps13 antikoerper, ribosomal protein S13 antikoerper, ribosomal protein13 antikoerper, 40S ribosomal protein S13 antikoerper, 30S ribosomal protein S13 antikoerper, ribosomal protein S13 L homeolog antikoerper, Rps13 antikoerper, RPS13 antikoerper, rps13 antikoerper, rps-13 antikoerper, rps13.L antikoerper
- Hintergrund
- Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S15P family of ribosomal proteins. It is located in the cytoplasm.
- Molekulargewicht
- 17 kDa (MW of target protein)
-