BPGM Antikörper (C-Term)

Produktnummer ABIN631502

Produktdetails anti-BPGM Antikörper

Target: BPGM (2,3-bisphosphoglycerate Mutase (BPGM))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BPGM Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: BPGM antibody was raised against the C terminal of BPGM

Aufreinigung: Affinity purified

Immunogen: BPGM antibody was raised using the C terminal of BPGM corresponding to a region with amino acids LPTGVPILLELDENLRAVGPHQFLGDQEAIQAAIKKVEDQGKVKQAKK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BPGM Blocking Peptide, catalog no. 33R-5292, is also available for use as a blocking control in assays to test for specificity of this BPGM antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BPGM antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BPGM

Target: BPGM (2,3-bisphosphoglycerate Mutase (BPGM))

Andere Bezeichnung: BPGM (BPGM Produkte)

Synonyme: DPGM antikoerper, AI323730 antikoerper, AL022789 antikoerper, C86192 antikoerper, Ab2-098 antikoerper, zgc:92230 antikoerper, Bisphosphoglycerate mutase antikoerper, bisphosphoglycerate mutase antikoerper, 2,3-bisphosphoglycerate mutase antikoerper, bisphosphoglycerate mutase S homeolog antikoerper, pmge antikoerper, BPGM antikoerper, Bpgm antikoerper, bpgm antikoerper, bpgm.S antikoerper

Hintergrund: BPGM belongs to the phosphoglycerate mutase family, BPG-dependent PGAM subfamily. It plays a major role in regulating hemoglobin oxygen affinity as a consequence of controlling 2,3-BPG concentration. It can also catalyze the reaction of EC 5.4.2.1 (mutase) and EC 3.1.3.13 (phosphatase), but with a reduced activity.

Molekulargewicht: 28 kDa (MW of target protein)