BPGM Antikörper (C-Term)
-
- Target Alle BPGM Antikörper anzeigen
- BPGM (2,3-bisphosphoglycerate Mutase (BPGM))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser BPGM Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- BPGM antibody was raised against the C terminal of BPGM
- Aufreinigung
- Affinity purified
- Immunogen
- BPGM antibody was raised using the C terminal of BPGM corresponding to a region with amino acids LPTGVPILLELDENLRAVGPHQFLGDQEAIQAAIKKVEDQGKVKQAKK
- Top Product
- Discover our top product BPGM Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
BPGM Blocking Peptide, catalog no. 33R-5292, is also available for use as a blocking control in assays to test for specificity of this BPGM antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BPGM antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- BPGM (2,3-bisphosphoglycerate Mutase (BPGM))
- Andere Bezeichnung
- BPGM (BPGM Produkte)
- Synonyme
- DPGM antikoerper, AI323730 antikoerper, AL022789 antikoerper, C86192 antikoerper, Ab2-098 antikoerper, zgc:92230 antikoerper, Bisphosphoglycerate mutase antikoerper, bisphosphoglycerate mutase antikoerper, 2,3-bisphosphoglycerate mutase antikoerper, bisphosphoglycerate mutase S homeolog antikoerper, pmge antikoerper, BPGM antikoerper, Bpgm antikoerper, bpgm antikoerper, bpgm.S antikoerper
- Hintergrund
- BPGM belongs to the phosphoglycerate mutase family, BPG-dependent PGAM subfamily. It plays a major role in regulating hemoglobin oxygen affinity as a consequence of controlling 2,3-BPG concentration. It can also catalyze the reaction of EC 5.4.2.1 (mutase) and EC 3.1.3.13 (phosphatase), but with a reduced activity.
- Molekulargewicht
- 28 kDa (MW of target protein)
-