SDSL Antikörper (N-Term)
-
- Target Alle SDSL Antikörper anzeigen
- SDSL (Serine Dehydratase-Like (SDSL))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SDSL Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SDSL antibody was raised against the N terminal of SDSL
- Aufreinigung
- Affinity purified
- Immunogen
- SDSL antibody was raised using the N terminal of SDSL corresponding to a region with amino acids MDGPVAEHAKQEPFHVVTPLLESWALSQVAGMPVFLKCENVQPSGSFKIR
- Top Product
- Discover our top product SDSL Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SDSL Blocking Peptide, catalog no. 33R-5836, is also available for use as a blocking control in assays to test for specificity of this SDSL antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SDSL antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SDSL (Serine Dehydratase-Like (SDSL))
- Andere Bezeichnung
- SDSL (SDSL Produkte)
- Synonyme
- MGC68790 antikoerper, SDSL antikoerper, sds-rs1 antikoerper, MGC159817 antikoerper, SDH 2 antikoerper, SDS-RS1 antikoerper, TDH antikoerper, 4432411H13Rik antikoerper, AI504310 antikoerper, SDH1 antikoerper, serine dehydratase like S homeolog antikoerper, serine dehydratase like antikoerper, serine dehydratase antikoerper, serine dehydratase-like antikoerper, sdsl.S antikoerper, SDSL antikoerper, sdsl antikoerper, SDS antikoerper, LOC100367535 antikoerper, LOC100539678 antikoerper, LOC100634528 antikoerper, Sdsl antikoerper
- Hintergrund
- SDSL has low serine dehydratase and threonine dehydratase activity.
- Molekulargewicht
- 35 kDa (MW of target protein)
-