beta Tubulin 2A (Middle Region) Antikörper

Produktnummer ABIN631482

Produktdetails

Target: beta Tubulin 2A

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte, Arabidopsis, Drosophila melanogaster

Wirt: Kaninchen

Klonalität: Polyklonal

Applikation: Western Blotting (WB)

Spezifität: Beta Tubulin 2 A antibody was raised against the middle region of TUBB2

Aufreinigung: Affinity purified

Immunogen: Beta Tubulin 2 A antibody was raised using the middle region of TUBB2 corresponding to a region with amino acids AVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAAC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Beta Tubulin 2A Blocking Peptide, catalog no. 33R-1609, is also available for use as a blocking control in assays to test for specificity of this Beta Tubulin 2A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUBB0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: beta Tubulin 2A

Synonyme: 2t antikoerper, B2t antikoerper, BETA 85D antikoerper, BETA2 antikoerper, CG9359 antikoerper, D.m.BETA-85D antikoerper, DTB4 antikoerper, Dmbeta2 antikoerper, Dmel\\CG9359 antikoerper, Tub antikoerper, beta(2)Tu antikoerper, beta(2)Tub antikoerper, beta-Tub85D antikoerper, beta-tub antikoerper, beta-tub85D antikoerper, beta2 antikoerper, beta2-tub antikoerper, beta2t antikoerper, beta2tub antikoerper, beta85D antikoerper, betaTub2 antikoerper, beta[[2]]-tubulin antikoerper, ms(3)KK[D] antikoerper, beta-Tubulin at 85D antikoerper, betaTub85D antikoerper

Hintergrund: TUBB2A belongs to the tubulin family. Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.

Molekulargewicht: 49 kDa (MW of target protein)