TOE1 Antikörper

Produktnummer ABIN631480

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch TOE1 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für TOE1 Antikörper (ABIN631480)

Target: TOE1 (Target of EGR1, Member 1 (Nuclear) (TOE1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TOE1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TOE1 Antikörper

Aufreinigung: Affinity purified

Immunogen: TOE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VVDVQSNNFKEMWPSLLLAIKTANFVAVDTELSGLGDRKSLLNQCIEERY

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TOE1 Blocking Peptide, (ABIN5616723), is also available for use as a blocking control in assays to test for specificity of this TOE1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TOE1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TOE1

Target: TOE1 (Target of EGR1, Member 1 (Nuclear) (TOE1))

Andere Bezeichnung: TOE1

Hintergrund: TOE1 belongs to the CAF1 family and 1 C3H1-type zinc finger. TOE1 inhibits cell growth rate and cell cycle. It induces CDKN1A expression as well as TGF-beta expression and mediates the inhibitory growth effect of EGR1.

Molekulargewicht: 56 kDa (MW of target protein)