TOE1 Antikörper
-
- Target Alle TOE1 Antikörper anzeigen
- TOE1 (Target of EGR1, Member 1 (Nuclear) (TOE1))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TOE1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- TOE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VVDVQSNNFKEMWPSLLLAIKTANFVAVDTELSGLGDRKSLLNQCIEERY
- Top Product
- Discover our top product TOE1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TOE1 Blocking Peptide, catalog no. 33R-9872, is also available for use as a blocking control in assays to test for specificity of this TOE1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TOE1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TOE1 (Target of EGR1, Member 1 (Nuclear) (TOE1))
- Andere Bezeichnung
- TOE1 (TOE1 Produkte)
- Synonyme
- 4930584N22Rik antikoerper, 4933424D16Rik antikoerper, AI413517 antikoerper, TOE1 antikoerper, si:dkey-40i22.3 antikoerper, target of EGR1, exonuclease antikoerper, target of EGR1, member 1 (nuclear) antikoerper, TOE1 antikoerper, Toe1 antikoerper, toe1 antikoerper
- Hintergrund
- TOE1 belongs to the CAF1 family and 1 C3H1-type zinc finger. TOE1 inhibits cell growth rate and cell cycle. It induces CDKN1A expression as well as TGF-beta expression and mediates the inhibitory growth effect of EGR1.
- Molekulargewicht
- 56 kDa (MW of target protein)
-