CDCA5 Antikörper (Middle Region)

Produktnummer ABIN631455

Produktdetails anti-CDCA5 Antikörper

Target: CDCA5 (Cell Division Cycle Associated 5 (CDCA5))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CDCA5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CDCA5 antibody was raised against the middle region of CDCA5

Aufreinigung: Affinity purified

Immunogen: CDCA5 antibody was raised using the middle region of CDCA5 corresponding to a region with amino acids RRSYSRLETLGSASTSTPGRRSCFGFEGLLGAEDLSGVSPVVCSKLTEVP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CDCA5 Blocking Peptide, catalog no. 33R-8165, is also available for use as a blocking control in assays to test for specificity of this CDCA5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDCA5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CDCA5

Target: CDCA5 (Cell Division Cycle Associated 5 (CDCA5))

Andere Bezeichnung: CDCA5 (CDCA5 Produkte)

Synonyme: SORORIN antikoerper, 2610036L13Rik antikoerper, AL024086 antikoerper, AW536684 antikoerper, C85404 antikoerper, CDCA5 antikoerper, RGD1560863 antikoerper, sororin antikoerper, cdca5 antikoerper, cell division cycle associated 5 antikoerper, cell division cycle associated 5 S homeolog antikoerper, CDCA5 antikoerper, Cdca5 antikoerper, cdca5 antikoerper, cdca5.S antikoerper

Hintergrund: CDCA5 is the regulator of sister chromatid cohesion in mitosis. It may act by regulating the ability of the cohesin complex to mediate sister chromatid cohesion, perhaps by altering the nature of the interaction of cohesin with the chromosomes.

Molekulargewicht: 28 kDa (MW of target protein)

Pathways: Chromatin Binding