KRT16 Antikörper

Produktnummer ABIN631442

Der Kaninchen Polyklonal anti-KRT16 Antikörper wird verwendet zum Nachweis von KRT16 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für KRT16 Antikörper (ABIN631442)

Target: KRT16 (Keratin 16 (KRT16))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KRT16 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-KRT16 Antikörper

Aufreinigung: Affinity purified

Immunogen: Cytokeratin 16 antibody was raised using a synthetic peptide corresponding to a region with amino acids IAATIENAQPILQIDNARLAADDFRTKYEHELALRQTVEADVNGLRRVLD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Cytokeratin 16 Blocking Peptide, (ABIN939275), is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 16 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT16 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KRT16

Target: KRT16 (Keratin 16 (KRT16))

Andere Bezeichnung: Cytokeratin 16

Hintergrund: KRT16 is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains and are clustered in a region of chromosome 17q12-q21. This keratin has been coexpressed with keratin 14 in a number of epithelial tissues, including esophagus, tongue, and hair follicles.

Molekulargewicht: 51 kDa (MW of target protein)