-
- Target Alle KRT16 Antikörper anzeigen
- KRT16 (Keratin 16 (KRT16))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KRT16 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- Cytokeratin 16 antibody was raised using a synthetic peptide corresponding to a region with amino acids IAATIENAQPILQIDNARLAADDFRTKYEHELALRQTVEADVNGLRRVLD
- Top Product
- Discover our top product KRT16 Primärantikörper
-
anti-Keratin 16 (KRT16) (AA 190-430) antibody
KRT16 Reaktivität: Human WB, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Keratin 16 (KRT16) antibodyKRT16 Reaktivität: Human WB, IHC, IF Wirt: Kaninchen Monoclonal unconjugated
anti-Keratin 16 (KRT16) (AA 265-333) antibodyKRT16 Reaktivität: Human WB, IHC, ELISA, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Keratin 16 (KRT16) antibodyKRT16 Reaktivität: Human, Maus, Ratte WB, IHC (p), IF (cc) Wirt: Kaninchen Monoclonal 1A4 unconjugated
anti-Keratin 16 (KRT16) (AA 117-419) antibodyKRT16 Reaktivität: Human WB, IHC, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Keratin 16 (KRT16) antibodyKRT16 Reaktivität: Human, Maus, Ratte WB, IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Keratin 16 (KRT16) antibodyKRT16 Reaktivität: Human, Maus, Ratte IHC (p), IF Wirt: Maus Monoclonal 3H4 unconjugated
anti-Keratin 16 (KRT16) (AA 1-473) antibodyKRT16 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Keratin 16 (KRT16) (N-Term) antibodyKRT16 Reaktivität: Human WB, IHC, ELISA, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Keratin 16 (KRT16) antibodyKRT16 Reaktivität: Human Wirt: Maus Monoclonal LL025 unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Cytokeratin 16 Blocking Peptide, catalog no. 33R-3889, is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 16 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT16 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KRT16 (Keratin 16 (KRT16))
- Andere Bezeichnung
- Cytokeratin 16 (KRT16 Produkte)
- Synonyme
- CK16 antikoerper, FNEPPK antikoerper, K16 antikoerper, K1CP antikoerper, KRT16A antikoerper, NEPPK antikoerper, AI324768 antikoerper, Krt1-16 antikoerper, Ka16 antikoerper, KRT16 antikoerper, Krt16 antikoerper, keratin 16 antikoerper, keratin 16, type I S homeolog antikoerper, keratin, type I cytoskeletal 16 antikoerper, KRT16 antikoerper, Krt16 antikoerper, krt16.S antikoerper, LOC101108147 antikoerper, LOC100714013 antikoerper
- Hintergrund
- KRT16 is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains and are clustered in a region of chromosome 17q12-q21. This keratin has been coexpressed with keratin 14 in a number of epithelial tissues, including esophagus, tongue, and hair follicles.
- Molekulargewicht
- 51 kDa (MW of target protein)
-
Sie sind hier:
