PEX26 Antikörper (Middle Region)
-
- Target Alle PEX26 Antikörper anzeigen
- PEX26 (Peroxisomal Biogenesis Factor 26 (PEX26))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PEX26 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PEX26 antibody was raised against the middle region of PEX26
- Aufreinigung
- Affinity purified
- Immunogen
- PEX26 antibody was raised using the middle region of PEX26 corresponding to a region with amino acids ELVVGSAAFGEERRLDVLQAIHTARQQQKQEHSGSEEAQKPNLEGSVSHK
- Top Product
- Discover our top product PEX26 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PEX26 Blocking Peptide, catalog no. 33R-2580, is also available for use as a blocking control in assays to test for specificity of this PEX26 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEX26 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PEX26 (Peroxisomal Biogenesis Factor 26 (PEX26))
- Andere Bezeichnung
- PEX26 (PEX26 Produkte)
- Synonyme
- fk41g06 antikoerper, zgc:64014 antikoerper, wu:fk41g06 antikoerper, PBD7A antikoerper, PBD7B antikoerper, PEX26M1T antikoerper, Pex26pM1T antikoerper, 4632428M11Rik antikoerper, AI853212 antikoerper, peroxisomal biogenesis factor 26 antikoerper, peroxisomal biogenesis factor 26 L homeolog antikoerper, pex26 antikoerper, PEX26 antikoerper, pex26.L antikoerper, Pex26 antikoerper
- Hintergrund
- This gene belongs to the peroxin-26 gene family. It is probably required for protein import into peroxisomes.
- Molekulargewicht
- 34 kDa (MW of target protein)
-