LOC645015 (N-Term) Antikörper

Produktnummer ABIN631428

Produktdetails

Target: LOC645015

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Applikation: Western Blotting (WB)

Spezifität: LOC645015 antibody was raised against the N terminal of LOC645015

Aufreinigung: Affinity purified

Immunogen: LOC645015 antibody was raised using the N terminal of LOC645015 corresponding to a region with amino acids HLCGTLACRPPSICCMLLTSRVATQTAIQTYQENPQASPEVPVLLGPCEP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LOC645015 Blocking Peptide, catalog no. 33R-3773, is also available for use as a blocking control in assays to test for specificity of this LOC645015 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LOC645015 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: LOC645015

Synonyme: asparagine-linked glycosylation 1-like 8, pseudogene antikoerper, ALG1L8P antikoerper

Hintergrund: The function of LOC645015 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 35 kDa (MW of target protein)