LOC645015 (N-Term) Antikörper
-
- Target
- LOC645015
- Bindungsspezifität
- N-Term
- Reaktivität
- Human
- Wirt
- Kaninchen
- Klonalität
- Polyklonal
- Applikation
- Western Blotting (WB)
- Spezifität
- LOC645015 antibody was raised against the N terminal of LOC645015
- Aufreinigung
- Affinity purified
- Immunogen
- LOC645015 antibody was raised using the N terminal of LOC645015 corresponding to a region with amino acids HLCGTLACRPPSICCMLLTSRVATQTAIQTYQENPQASPEVPVLLGPCEP
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LOC645015 Blocking Peptide, catalog no. 33R-3773, is also available for use as a blocking control in assays to test for specificity of this LOC645015 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LOC645015 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LOC645015
- Synonyme
- asparagine-linked glycosylation 1-like 8, pseudogene antikoerper, ALG1L8P antikoerper
- Hintergrund
- The function of LOC645015 protein has not been widely studied, and is yet to be fully elucidated.
- Molekulargewicht
- 35 kDa (MW of target protein)
-