alpha Actinin 4 Antikörper (C-Term)
-
- Target Alle alpha Actinin 4 (ACTN4) Antikörper anzeigen
- alpha Actinin 4 (ACTN4) (Actinin, alpha 4 (ACTN4))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser alpha Actinin 4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Alpha Actinin 4 antibody was raised against the C terminal of ACTN4
- Aufreinigung
- Affinity purified
- Immunogen
- alpha Actinin 4 antibody was raised using the C terminal of ACTN4 corresponding to a region with amino acids DVENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETTDTDTADQVI
- Top Product
- Discover our top product ACTN4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Alpha Actinin 4 Blocking Peptide, catalog no. 33R-2213, is also available for use as a blocking control in assays to test for specificity of this Alpha Actinin 4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTN4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- alpha Actinin 4 (ACTN4) (Actinin, alpha 4 (ACTN4))
- Andere Bezeichnung
- alpha Actinin 4 (ACTN4 Produkte)
- Synonyme
- fsgs antikoerper, fsgs1 antikoerper, C77391 antikoerper, ACTININ-4 antikoerper, FSGS antikoerper, FSGS1 antikoerper, wu:fb53f05 antikoerper, zgc:63508 antikoerper, actinin alpha 4 antikoerper, actinin, alpha 4 antikoerper, actinin alpha 4 S homeolog antikoerper, actn4 antikoerper, ACTN4 antikoerper, Actn4 antikoerper, actn4.S antikoerper
- Hintergrund
- Alpha actinins belong to the spectrin superfamily which is a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. ACTN4 is a nonmuscle, alpha actinin isoform which is concentrated in the cytoplasm, and thought to be involved in metastatic processes. Mutations in its gene have been associated with focal and segmental glomerulosclerosis.
- Molekulargewicht
- 105 kDa (MW of target protein)
- Pathways
- Proton Transport
-