KLHL15 Antikörper

Produktnummer ABIN631407

Produktdetails anti-KLHL15 Antikörper

Target: KLHL15 (Kelch-Like 15 (KLHL15))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KLHL15 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: KLHL15 antibody was raised using a synthetic peptide corresponding to a region with amino acids VLDKQIMVLGGLCYNGHYSDSILTFDPDENKWKEDEYPRMPCKLDGLQVC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KLHL15 Blocking Peptide, catalog no. 33R-9645, is also available for use as a blocking control in assays to test for specificity of this KLHL15 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHL15 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KLHL15

Target: KLHL15 (Kelch-Like 15 (KLHL15))

Andere Bezeichnung: KLHL15 (KLHL15 Produkte)

Synonyme: 6330500C13Rik antikoerper, wu:fa66h10 antikoerper, zgc:101051 antikoerper, RGD1563101 antikoerper, kelch-like 15 antikoerper, kelch-like family member 15 antikoerper, kelch like family member 15 antikoerper, Klhl15 antikoerper, klhl15 antikoerper, KLHL15 antikoerper

Hintergrund: KLHL15 is a member of the kelch-like family of proteins that share a common domain structure consisting of an N-terminal broad-complex, tramtrack, bric-a-brac/poxvirus and zinc finger domain and C-terminal kelch repeat motifs. KLHL15 may be involved in protein ubiquitination and cytoskeletal organization.

Molekulargewicht: 66 kDa (MW of target protein)