FAU Antikörper

Produktnummer ABIN631405

Produktdetails anti-FAU Antikörper

Target: FAU (Finkel-Biskis-Reilly Murine Sarcoma Virus (FBR-MuSV) Ubiquitously Expressed (FAU))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAU Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: FAU antibody was raised using a synthetic peptide corresponding to a region with amino acids VRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAU Blocking Peptide, catalog no. 33R-9774, is also available for use as a blocking control in assays to test for specificity of this FAU antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAU antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAU

Target: FAU (Finkel-Biskis-Reilly Murine Sarcoma Virus (FBR-MuSV) Ubiquitously Expressed (FAU))

Andere Bezeichnung: FAU (FAU Produkte)

Synonyme: FAU1 antikoerper, Fub1 antikoerper, Fubi antikoerper, MNSFbeta antikoerper, RPS30 antikoerper, S30 antikoerper, asr1 antikoerper, Asr1 antikoerper, MGC73171 antikoerper, zgc:73171 antikoerper, FAU, ubiquitin like and ribosomal protein S30 fusion antikoerper, Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed (fox derived) antikoerper, Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed a antikoerper, FAU antikoerper, Fau antikoerper, faua antikoerper

Hintergrund: FAU is a fusion protein consisting of the ubiquitin-like protein fubi at the N terminus and ribosomal protein S30 at the C terminus. It has been proposed that the fusion protein is post-translationally processed to generate free fubi and free ribosomal protein S30. Fubi is a member of the ubiquitin family, and ribosomal protein S30 belongs to the S30E family of ribosomal proteins. Whereas the function of fubi is currently unknown, ribosomal protein S30 is a component of the 40S subunit of the cytoplasmic ribosome.

Molekulargewicht: 14 kDa (MW of target protein)