CHPF2 Antikörper (N-Term)

Produktnummer ABIN631398

Produktdetails anti-CHPF2 Antikörper

Target: CHPF2 (Chondroitin Polymerizing Factor 2 (CHPF2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CHPF2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CSGLCA-T antibody was raised against the N terminal Of Csglca-T

Aufreinigung: Affinity purified

Immunogen: CSGLCA-T antibody was raised using the N terminal Of Csglca-T corresponding to a region with amino acids SLLRVSWIQGEGEDPCVEAVGERGGPQNPDSRARLDQSDEDFKPRIVPYY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CSGLCA-T Blocking Peptide, catalog no. 33R-8608, is also available for use as a blocking control in assays to test for specificity of this CSGLCA-T antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSGLCA-T antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CHPF2

Target: CHPF2 (Chondroitin Polymerizing Factor 2 (CHPF2))

Andere Bezeichnung: CSGLCA-T (CHPF2 Produkte)

Synonyme: RGD1306404 antikoerper, AW060945 antikoerper, mKIAA1402 antikoerper, 2010209O12Rik antikoerper, CSGLCA-T antikoerper, CSGlcAT antikoerper, ChSy-3 antikoerper, chondroitin polymerizing factor 2 antikoerper, Chpf2 antikoerper, CHPF2 antikoerper, chpf2 antikoerper

Hintergrund: CSGlcA-T belongs to the chondroitin N-acetylgalactosaminyltransferase family. It transfers glucuronic acid (GlcUA) from UDP-GlcUA to N-acetylgalactosamine residues on the non-reducing end of the elongating chondroitin polymer. CSGlcA-T has no N-acetylgalactosaminyltransferase activity.

Molekulargewicht: 18 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process