TRIM55 Antikörper (Middle Region)

Produktnummer ABIN631395

Produktdetails anti-TRIM55 Antikörper

Target: TRIM55 (Tripartite Motif Containing 55 (TRIM55))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TRIM55 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TRIM55 antibody was raised against the middle region of TRIM55

Aufreinigung: Affinity purified

Immunogen: TRIM55 antibody was raised using the middle region of TRIM55 corresponding to a region with amino acids SGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESTRPEKKSDQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TRIM55 Blocking Peptide, catalog no. 33R-8465, is also available for use as a blocking control in assays to test for specificity of this TRIM55 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM55 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TRIM55

Target: TRIM55 (Tripartite Motif Containing 55 (TRIM55))

Andere Bezeichnung: TRIM55 (TRIM55 Produkte)

Synonyme: MURF-2 antikoerper, RNF29 antikoerper, muRF2 antikoerper, trim55 antikoerper, wu:fb71c01 antikoerper, zgc:92123 antikoerper, TRIM55 antikoerper, im:7145460 antikoerper, zgc:136833 antikoerper, D830041C10Rik antikoerper, Murf2 antikoerper, Rnf29 antikoerper, murf-2 antikoerper, rnf29 antikoerper, tripartite motif containing 55 antikoerper, tripartite motif containing 55a antikoerper, tripartite motif containing 55b antikoerper, tripartite motif-containing 55 antikoerper, tripartite motif containing 55 L homeolog antikoerper, TRIM55 antikoerper, trim55a antikoerper, trim55b antikoerper, Trim55 antikoerper, trim55.L antikoerper

Hintergrund: TRIM55 contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein associates transiently with microtubules, myosin, and titin during muscle sarcomere assembly. It may act as a transient adaptor and plays a regulatory role in the assembly of sarcomeres.

Molekulargewicht: 27 kDa (MW of target protein)