NUDT13 Antikörper

Produktnummer ABIN631331

Produktdetails anti-NUDT13 Antikörper

Target: NUDT13 (Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 13 (NUDT13))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NUDT13 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: NUDT13 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSLYCGIACRRKFFWCYRLLSTYVTKTRYLFELKEDDDACKKAQQTGAFY

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NUDT13 Blocking Peptide, catalog no. 33R-6470, is also available for use as a blocking control in assays to test for specificity of this NUDT13 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUDT13 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NUDT13

Target: NUDT13 (Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 13 (NUDT13))

Andere Bezeichnung: NUDT13 (NUDT13 Produkte)

Synonyme: si:ch211-146f4.4 antikoerper, 4933433B15Rik antikoerper, nudix (nucleoside diphosphate linked moiety X)-type motif 13 antikoerper, uncharacterized LOC100157023 antikoerper, nudix hydrolase 13 L homeolog antikoerper, nudix hydrolase 13 antikoerper, nudt13 antikoerper, LOC100157023 antikoerper, nudt13.L antikoerper, NUDT13 antikoerper, Nudt13 antikoerper

Hintergrund: NUDT13 contains 1 nudix hydrolase domain. The exact function of NUDT13 remains unknown.

Molekulargewicht: 40 kDa (MW of target protein)