TTC6 Antikörper (C-Term)
-
- Target Alle TTC6 Produkte
- TTC6 (Tetratricopeptide Repeat Domain 6 (TTC6))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TTC6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TTC6 antibody was raised against the C terminal of TTC6
- Aufreinigung
- Affinity purified
- Immunogen
- TTC6 antibody was raised using the C terminal of TTC6 corresponding to a region with amino acids MKDYQDAITLNPKYSLAYFNAGNIYFHHRQFSQASDYFSKALKFDPENEY
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TTC6 Blocking Peptide, catalog no. 33R-6131, is also available for use as a blocking control in assays to test for specificity of this TTC6 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TTC6 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TTC6 (Tetratricopeptide Repeat Domain 6 (TTC6))
- Andere Bezeichnung
- TTC6 (TTC6 Produkte)
- Synonyme
- C14orf25 antikoerper, NCRNA00291 antikoerper, 4921506M07Rik antikoerper, EG639426 antikoerper, Gm69 antikoerper, Gm9813 antikoerper, tetratricopeptide repeat domain 6 antikoerper, TTC6 antikoerper, Ttc6 antikoerper
- Hintergrund
- TTC6 is involved in protein binding.
- Molekulargewicht
- 59 kDa (MW of target protein)
-