EEF1G Antikörper (Middle Region)
-
- Target Alle EEF1G Antikörper anzeigen
- EEF1G (Eukaryotic Translation Elongation Factor 1 gamma (EEF1G))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser EEF1G Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- EEF1 G antibody was raised against the middle region of EEF1
- Aufreinigung
- Affinity purified
- Immunogen
- EEF1 G antibody was raised using the middle region of EEF1 corresponding to a region with amino acids RAVLGEVKLCEKMAQFDAKKFAETQPKKDTPRKEKGSREEKQKPQAERKE
- Top Product
- Discover our top product EEF1G Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
EEF1G Blocking Peptide, catalog no. 33R-7829, is also available for use as a blocking control in assays to test for specificity of this EEF1G antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EEF0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EEF1G (Eukaryotic Translation Elongation Factor 1 gamma (EEF1G))
- Andere Bezeichnung
- EEF1G (EEF1G Produkte)
- Synonyme
- EF1G antikoerper, GIG35 antikoerper, eEF-1 gamma antikoerper, db03h10 antikoerper, fk76a09 antikoerper, mg:db03h10 antikoerper, wu:fk76a09 antikoerper, 2610301D06Rik antikoerper, AA407312 antikoerper, eef1g antikoerper, ef1g antikoerper, gig35 antikoerper, eukaryotic translation elongation factor 1 gamma antikoerper, eukaryotic translation elongation factor 1 gamma L homeolog antikoerper, eukaryotic translation elongation factor 1 gamma S homeolog antikoerper, EEF1G antikoerper, eef1g antikoerper, Eef1g antikoerper, eef1g.L antikoerper, eef1g.S antikoerper, EHI_119540 antikoerper, CMU_014590 antikoerper
- Hintergrund
- EEF1G is a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit contains an N-terminal glutathione transferase domain, which may be involved in regulating the assembly of multisubunit complexes containing this elongation factor and aminoacyl-tRNA synthetases.
- Molekulargewicht
- 50 kDa (MW of target protein)
-