TRIM36 Antikörper (Middle Region)
-
- Target Alle TRIM36 Antikörper anzeigen
- TRIM36 (Tripartite Motif Containing 36 (TRIM36))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TRIM36 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TRIM36 antibody was raised against the middle region of TRIM36
- Aufreinigung
- Affinity purified
- Immunogen
- TRIM36 antibody was raised using the middle region of TRIM36 corresponding to a region with amino acids GYIMELIAKGKASAMGLQQTHEHSRLTSKGGEARCPFEISEVGKQSLPRR
- Top Product
- Discover our top product TRIM36 Primärantikörper
-
anti-Tripartite Motif Containing 36 (TRIM36) (AA 391-499) antibody
TRIM36 Reaktivität: Human WB, ELISA, IHC (p), IF Wirt: Maus Monoclonal 2D11 unconjugated
anti-Tripartite Motif Containing 36 (TRIM36) (AA 310-339) antibodyTRIM36 Reaktivität: Human, Maus WB, IHC (p) Wirt: Kaninchen Polyclonal RB30254 unconjugated
anti-Tripartite Motif Containing 36 (TRIM36) (AA 70-280) antibodyTRIM36 Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Tripartite Motif Containing 36 (TRIM36) (C-Term) antibodyTRIM36 Reaktivität: Human WB, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Tripartite Motif Containing 36 (TRIM36) (C-Term) antibodyVerified TRIM36 Reaktivität: Human WB, ELISA Wirt: Ziege Polyclonal unconjugated
anti-Tripartite Motif Containing 36 (TRIM36) (C-Term) antibodyTRIM36 Reaktivität: Human, Affe WB Wirt: Kaninchen Polyclonal unconjugated
anti-Tripartite Motif Containing 36 (TRIM36) (AA 166-215) antibodyTRIM36 Reaktivität: Human, Maus, Ratte, Meerschweinchen, Pferd, Kaninchen, Zebrafisch (Danio rerio), Rind (Kuh), Hund, Affe, Fledermaus, Schwein WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TRIM36 Blocking Peptide, catalog no. 33R-3678, is also available for use as a blocking control in assays to test for specificity of this TRIM36 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM36 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TRIM36 (Tripartite Motif Containing 36 (TRIM36))
- Andere Bezeichnung
- TRIM36 (TRIM36 Produkte)
- Synonyme
- wu:fj48f01 antikoerper, zgc:153447 antikoerper, zgc:63476 antikoerper, Haprin antikoerper, MGC81170 antikoerper, TRIM36 antikoerper, HAPRIN antikoerper, RBCC728 antikoerper, RNF98 antikoerper, D18Wsu100e antikoerper, haprin antikoerper, tripartite motif containing 36 antikoerper, tripartite motif containing 36 L homeolog antikoerper, tripartite motif-containing 36 antikoerper, trim36 antikoerper, trim36.L antikoerper, TRIM36 antikoerper, Trim36 antikoerper
- Hintergrund
- The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region.
- Molekulargewicht
- 7 kDa (MW of target protein)
-
