CRABP2 Antikörper (Middle Region)

Produktnummer ABIN631322

Produktdetails anti-CRABP2 Antikörper

Target: CRABP2 (Cellular Retinoic Acid Binding Protein 2 (CRABP2))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CRABP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CRABP2 antibody was raised against the middle region of CRABP2

Aufreinigung: Affinity purified

Immunogen: CRABP2 antibody was raised using the middle region of CRABP2 corresponding to a region with amino acids FEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CRABP2 Blocking Peptide, catalog no. 33R-2877, is also available for use as a blocking control in assays to test for specificity of this CRABP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRABP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CRABP2

Target: CRABP2 (Cellular Retinoic Acid Binding Protein 2 (CRABP2))

Andere Bezeichnung: CRABP2 (CRABP2 Produkte)

Synonyme: crabp antikoerper, crabp2-A antikoerper, xCRABP antikoerper, xCRABP-b antikoerper, cb432 antikoerper, cb434 antikoerper, crabp2 antikoerper, sb:cb434 antikoerper, wu:fc51a11 antikoerper, zgc:110496 antikoerper, CRABP2 antikoerper, rbp6 antikoerper, MGC89469 antikoerper, crabp-ii antikoerper, CRABP-II antikoerper, RBP6 antikoerper, AI893628 antikoerper, Crabp-2 antikoerper, CrabpII antikoerper, im:7136989 antikoerper, cellular retinoic acid binding protein 2 L homeolog antikoerper, cellular retinoic acid binding protein 2, a antikoerper, cellular retinoic acid binding protein 2 antikoerper, cellular retinoic acid binding protein II antikoerper, cellular retinoic acid binding protein 2, b antikoerper, crabp2.L antikoerper, crabp2a antikoerper, CRABP2 antikoerper, crabp2 antikoerper, Crabp2 antikoerper, crabp2b antikoerper

Hintergrund: A number of specific carrier proteins for members of the vitamin A family have been discovered. Cellular retinoic acid binding proteins (CRABP) are low molecular weight proteins whose precise function remains unknown. The inducibility of the CRABP2 geneuggests that this isoform is important in retinoic acid-mediated regulation of human skin growth and differentiation. It has been postulated that the CRABP2 gene is transcriptionally regulated by a newly synthesized regulatory protein.

Molekulargewicht: 16 kDa (MW of target protein)