LSS Antikörper

Produktnummer ABIN631321

Produktdetails anti-LSS Antikörper

Target: LSS (Lanosterol Synthase (2,3-Oxidosqualene-Lanosterol Cyclase) (LSS))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LSS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: LSS antibody was raised using a synthetic peptide corresponding to a region with amino acids TEGTCLRRRGGPYKTEPATDLGRWRLNCERGRQTWTYLQDERAGREQTGL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LSS Blocking Peptide, catalog no. 33R-9038, is also available for use as a blocking control in assays to test for specificity of this LSS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LSS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LSS

Target: LSS (Lanosterol Synthase (2,3-Oxidosqualene-Lanosterol Cyclase) (LSS))

Andere Bezeichnung: LSS (LSS Produkte)

Synonyme: OSC antikoerper, 2810025N20Rik antikoerper, BC029082 antikoerper, D10Ertd116e antikoerper, Osc antikoerper, xlss antikoerper, Tb07.27E10.490 antikoerper, NCU01119.1 antikoerper, lanosterol synthase antikoerper, lanosterol synthase (2,3-oxidosqualene-lanosterol cyclase) antikoerper, putative lanosterol synthase antikoerper, Lanosterol synthase, putative antikoerper, LSS antikoerper, Lss antikoerper, lss antikoerper, CND02520 antikoerper, Tc00.1047053506825.170 antikoerper, Tc00.1047053508175.70 antikoerper, Tb927.7.5230 antikoerper, NCU01119 antikoerper, LMJF_06_0650 antikoerper, CGB_D5080W antikoerper, LOC100636608 antikoerper

Hintergrund: LSS catalyzes the conversion of (S)-2,3 oxidosqualene to lanosterol. It is a member of the terpene cyclase/mutase family and catalyzes the first step in the biosynthesis of cholesterol, steroid hormones, and vitamin D. Two transcript variants encoding the same protein have been found for this gene.

Molekulargewicht: 83 kDa (MW of target protein)