UBE2L3 Antikörper (Middle Region)
-
- Target Alle UBE2L3 Antikörper anzeigen
- UBE2L3 (Ubiquitin-Conjugating Enzyme E2L 3 (UBE2L3))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser UBE2L3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- UBE2 L3 antibody was raised against the middle region of UBE2 3
- Aufreinigung
- Affinity purified
- Immunogen
- UBE2 L3 antibody was raised using the middle region of UBE2 3 corresponding to a region with amino acids WQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQ
- Top Product
- Discover our top product UBE2L3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
UBE2L3 Blocking Peptide, catalog no. 33R-9992, is also available for use as a blocking control in assays to test for specificity of this UBE2L3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UBE2L3 (Ubiquitin-Conjugating Enzyme E2L 3 (UBE2L3))
- Andere Bezeichnung
- UBE2L3 (UBE2L3 Produkte)
- Synonyme
- E2-F1 antikoerper, L-UBC antikoerper, UBCH7 antikoerper, UbcM4 antikoerper, C79827 antikoerper, Ubce7 antikoerper, ube2l3 antikoerper, wu:fc22h11 antikoerper, zgc:86727 antikoerper, UBE2L3 antikoerper, ube2l3l antikoerper, wu:fb38h03 antikoerper, ubiquitin conjugating enzyme E2 L3 antikoerper, ubiquitin-conjugating enzyme E2L 3 antikoerper, ubiquitin-conjugating enzyme E2L 3a antikoerper, ubiquitin conjugating enzyme E2 L3 S homeolog antikoerper, ubiquitin-conjugating enzyme E2L 3b antikoerper, UBE2L3 antikoerper, Ube2l3 antikoerper, ube2l3a antikoerper, ube2l3.S antikoerper, ube2l3b antikoerper
- Hintergrund
- UBE2L3 catalyzes the covalent attachment of ubiquitin to other proteins.It mediates the selective degradation of short-lived and abnormal proteins. UBE2L3 functions in the E6/E6-AP-induced ubiquitination of p53/TP53.
- Molekulargewicht
- 18 kDa (MW of target protein)
-