PTGES3 Antikörper

Produktnummer ABIN631318

Produktdetails anti-PTGES3 Antikörper

Target: PTGES3 (Prostaglandin E Synthase 3 (Cytosolic) (PTGES3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PTGES3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: PTGES3 antibody was raised using a synthetic peptide corresponding to a region with amino acids KDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PTGES3 Blocking Peptide, catalog no. 33R-4309, is also available for use as a blocking control in assays to test for specificity of this PTGES3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTGES3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PTGES3

Target: PTGES3 (Prostaglandin E Synthase 3 (Cytosolic) (PTGES3))

Andere Bezeichnung: PTGES3 (PTGES3 Produkte)

Synonyme: P23 antikoerper, TEBP antikoerper, cPGES antikoerper, PTGES3 antikoerper, 5730442A20Rik antikoerper, Ptges antikoerper, Tebp antikoerper, p23 antikoerper, sid3177 antikoerper, RGD1561913 antikoerper, CPGES antikoerper, cPGES-1 antikoerper, ptges3 antikoerper, wu:fb98d06 antikoerper, zgc:65804 antikoerper, zgc:77131 antikoerper, tebp antikoerper, wu:fb50a04 antikoerper, zgc:86751 antikoerper, prostaglandin E synthase 3 antikoerper, prostaglandin E synthase 3 (cytosolic) pseudogene antikoerper, prostaglandin E synthase 3a (cytosolic) antikoerper, prostaglandin E synthase 3 L homeolog antikoerper, prostaglandin E synthase 3b (cytosolic) antikoerper, PTGES3 antikoerper, LOC743066 antikoerper, Ptges3 antikoerper, ptges3a antikoerper, ptges3.L antikoerper, ptges3b antikoerper

Hintergrund: PTGES3 is a molecular chaperone that localizes to genomic response elements in a hormone-dependent manner and disrupts receptor-mediated transcriptional activation, by promoting disassembly of transcriptional regulatory complexes.

Molekulargewicht: 18 kDa (MW of target protein)

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway, Cellular Glucan Metabolic Process