FBXL5 Antikörper (Middle Region)

Produktnummer ABIN631308

Produktdetails anti-FBXL5 Antikörper

Target: FBXL5 (F-Box and Leucine-Rich Repeat Protein 5 (FBXL5))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FBXL5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FBXL5 antibody was raised against the middle region of FBXL5

Aufreinigung: Affinity purified

Immunogen: FBXL5 antibody was raised using the middle region of FBXL5 corresponding to a region with amino acids LRTMSSLPESSAMCRKAARTRLPRGKDLIYFGSEKSDQETGRVLLFLSLS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FBXL5 Blocking Peptide, catalog no. 33R-5399, is also available for use as a blocking control in assays to test for specificity of this FBXL5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXL5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FBXL5

Target: FBXL5 (F-Box and Leucine-Rich Repeat Protein 5 (FBXL5))

Andere Bezeichnung: FBXL5 (FBXL5 Produkte)

Synonyme: fbxl5 antikoerper, MGC53238 antikoerper, FBXL5 antikoerper, FBL4 antikoerper, FBL5 antikoerper, FLR1 antikoerper, Fbl4 antikoerper, Fir4 antikoerper, wu:fb52d06 antikoerper, F-box and leucine rich repeat protein 5 antikoerper, F-box and leucine-rich repeat protein 5 S homeolog antikoerper, F-box and leucine-rich repeat protein 5 L homeolog antikoerper, F-box and leucine-rich repeat protein 5 antikoerper, FBXL5 antikoerper, fbxl5.S antikoerper, fbxl5.L antikoerper, fbxl5 antikoerper, Fbxl5 antikoerper

Hintergrund: FBXL5 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination.

Molekulargewicht: 63 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis