FBXL5 Antikörper (Middle Region)
-
- Target Alle FBXL5 Antikörper anzeigen
- FBXL5 (F-Box and Leucine-Rich Repeat Protein 5 (FBXL5))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FBXL5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FBXL5 antibody was raised against the middle region of FBXL5
- Aufreinigung
- Affinity purified
- Immunogen
- FBXL5 antibody was raised using the middle region of FBXL5 corresponding to a region with amino acids LRTMSSLPESSAMCRKAARTRLPRGKDLIYFGSEKSDQETGRVLLFLSLS
- Top Product
- Discover our top product FBXL5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FBXL5 Blocking Peptide, catalog no. 33R-5399, is also available for use as a blocking control in assays to test for specificity of this FBXL5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXL5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FBXL5 (F-Box and Leucine-Rich Repeat Protein 5 (FBXL5))
- Andere Bezeichnung
- FBXL5 (FBXL5 Produkte)
- Synonyme
- fbxl5 antikoerper, MGC53238 antikoerper, FBXL5 antikoerper, FBL4 antikoerper, FBL5 antikoerper, FLR1 antikoerper, Fbl4 antikoerper, Fir4 antikoerper, wu:fb52d06 antikoerper, F-box and leucine rich repeat protein 5 antikoerper, F-box and leucine-rich repeat protein 5 S homeolog antikoerper, F-box and leucine-rich repeat protein 5 L homeolog antikoerper, F-box and leucine-rich repeat protein 5 antikoerper, FBXL5 antikoerper, fbxl5.S antikoerper, fbxl5.L antikoerper, fbxl5 antikoerper, Fbxl5 antikoerper
- Hintergrund
- FBXL5 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination.
- Molekulargewicht
- 63 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis
-