FIL1L Antikörper (Middle Region)

Produktnummer ABIN631303

Produktdetails anti-FIL1L Antikörper

Target: FIL1L (FILIP1L) (Filamin A Interacting Protein 1-Like (FILIP1L))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FIL1L Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FILIP1 L antibody was raised against the middle region of FILIP1

Aufreinigung: Affinity purified

Immunogen: FILIP1 L antibody was raised using the middle region of FILIP1 corresponding to a region with amino acids KSLRPSLNGRRISDPQVFSKEVQTEAVDNEPPDYKSLIPLERAVINGQLY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FILIP1L Blocking Peptide, catalog no. 33R-4655, is also available for use as a blocking control in assays to test for specificity of this FILIP1L antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FILIP0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FIL1L

Target: FIL1L (FILIP1L) (Filamin A Interacting Protein 1-Like (FILIP1L))

Andere Bezeichnung: FILIP1L (FILIP1L Produkte)

Synonyme: DOC-1 antikoerper, DOC1 antikoerper, GIP130 antikoerper, GIP130a antikoerper, GIP130b antikoerper, GIP130c antikoerper, GIP90 antikoerper, 4631422O05Rik antikoerper, Doc1 antikoerper, FILIP1L antikoerper, filamin A interacting protein 1 like antikoerper, filamin A interacting protein 1-like antikoerper, FILIP1L antikoerper, Filip1l antikoerper, filip1l antikoerper

Hintergrund: FILIP1L acts as a regulator of the antiangiogenic activity on endothelial cells. When overexpressed in endothelial cells, FILIP1L leads to inhibition of cell proliferation and migration and an increase in apoptosis.

Molekulargewicht: 102 kDa (MW of target protein)