PANK4 Antikörper (Middle Region)

Produktnummer ABIN631284

Der Kaninchen Polyklonal anti-PANK4 Antikörper (ABIN631284) detektiert spezifisch PANK4 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für PANK4 Antikörper (Middle Region) (ABIN631284)

Target: PANK4 (Pantothenate Kinase 4 (PANK4))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PANK4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PANK4 Antikörper

Bindungsspezifität: Middle Region

Spezifität: PANK4 antibody was raised against the middle region of PANK4

Aufreinigung: Affinity purified

Immunogen: PANK4 antibody was raised using the middle region of PANK4 corresponding to a region with amino acids LGAIGAFLKGAEQDNPNQYSWGENYAGSSGLMSASPELGPAQRARSGTFD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PANK4 Blocking Peptide, (ABIN940348), is also available for use as a blocking control in assays to test for specificity of this PANK4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PANK4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PANK4

Target: PANK4 (Pantothenate Kinase 4 (PANK4))

Andere Bezeichnung: PANK4

Hintergrund: This gene encodes a protein belonging to the pantothenate kinase family. Pantothenate kinase is a key regulatory enzyme in the biosynthesis of coenzyme A (CoA) in bacteria and mammalian cells.

Molekulargewicht: 86 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process