PANK4 Antikörper (Middle Region)
-
- Target Alle PANK4 Antikörper anzeigen
- PANK4 (Pantothenate Kinase 4 (PANK4))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PANK4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PANK4 antibody was raised against the middle region of PANK4
- Aufreinigung
- Affinity purified
- Immunogen
- PANK4 antibody was raised using the middle region of PANK4 corresponding to a region with amino acids LGAIGAFLKGAEQDNPNQYSWGENYAGSSGLMSASPELGPAQRARSGTFD
- Top Product
- Discover our top product PANK4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PANK4 Blocking Peptide, catalog no. 33R-4962, is also available for use as a blocking control in assays to test for specificity of this PANK4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PANK4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PANK4 (Pantothenate Kinase 4 (PANK4))
- Andere Bezeichnung
- PANK4 (PANK4 Produkte)
- Synonyme
- zgc:66285 antikoerper, MGC142618 antikoerper, D030031I12Rik antikoerper, R75150 antikoerper, Fang1 antikoerper, pantothenate kinase 4 antikoerper, pank4 antikoerper, PANK4 antikoerper, LOC100283180 antikoerper, Pank4 antikoerper
- Hintergrund
- This gene encodes a protein belonging to the pantothenate kinase family. Pantothenate kinase is a key regulatory enzyme in the biosynthesis of coenzyme A (CoA) in bacteria and mammalian cells.
- Molekulargewicht
- 86 kDa (MW of target protein)
- Pathways
- Ribonucleoside Biosynthetic Process
-