PPM1B Antikörper

Produktnummer ABIN631255

Produktdetails anti-PPM1B Antikörper

Target: PPM1B (Protein Phosphatase, Mg2+/Mn2+ Dependent, 1B (PPM1B))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PPM1B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: PPM1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids EIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSRLN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PPM1B Blocking Peptide, catalog no. 33R-2480, is also available for use as a blocking control in assays to test for specificity of this PPM1B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPM0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PPM1B

Target: PPM1B (Protein Phosphatase, Mg2+/Mn2+ Dependent, 1B (PPM1B))

Andere Bezeichnung: PPM1B (PPM1B Produkte)

Synonyme: PP2C-beta-X antikoerper, PP2CB antikoerper, PP2CBETA antikoerper, PPC2BETAX antikoerper, Pp2c2 antikoerper, fc18g04 antikoerper, ppm1a antikoerper, wu:fc18g04 antikoerper, zgc:92329 antikoerper, pp2c-beta-x antikoerper, pp2cb antikoerper, pp2cbeta antikoerper, ppc2betax antikoerper, zgc:92031 antikoerper, protein phosphatase, Mg2+/Mn2+ dependent 1B antikoerper, protein phosphatase 1B, magnesium dependent, beta isoform antikoerper, protein phosphatase, Mg2+/Mn2+ dependent, 1B antikoerper, protein phosphatase, Mg2+/Mn2+ dependent, 1Bb antikoerper, protein phosphatase, Mg2+/Mn2+ dependent 1B L homeolog antikoerper, protein phosphatase, Mg2+/Mn2+ dependent, 1Ba antikoerper, PPM1B antikoerper, Ppm1b antikoerper, ppm1bb antikoerper, ppm1b.L antikoerper, ppm1ba antikoerper

Hintergrund: The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase has been shown to dephosphorylate cyclin-dependent

Molekulargewicht: 21 kDa (MW of target protein)