AKAP7 Antikörper

Produktnummer ABIN631246

Produktdetails anti-AKAP7 Antikörper

Target: AKAP7 (A Kinase (PRKA) Anchor Protein 7 (AKAP7))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AKAP7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: AKAP7 antibody was raised using a synthetic peptide corresponding to a region with amino acids MGQLCCFPFSRDEGKISELESSSSAVLQRYSKDIPSWSSGEKNGGEPDDA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AKAP7 Blocking Peptide, catalog no. 33R-6062, is also available for use as a blocking control in assays to test for specificity of this AKAP7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AKAP7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AKAP7

Target: AKAP7 (A Kinase (PRKA) Anchor Protein 7 (AKAP7))

Andere Bezeichnung: AKAP7 (AKAP7 Produkte)

Synonyme: akap15 antikoerper, akap18 antikoerper, MGC83920 antikoerper, AKAP7 antikoerper, AKAP15 antikoerper, AKAP18 antikoerper, 6430401D08 antikoerper, AI662165 antikoerper, Akap18 antikoerper, BB170514 antikoerper, AKAP-18 antikoerper, AKAP18d antikoerper, Akap15 antikoerper, A-kinase anchoring protein 7 antikoerper, A-kinase anchoring protein 7 L homeolog antikoerper, A kinase (PRKA) anchor protein 7 antikoerper, AKAP7 antikoerper, akap7.L antikoerper, akap7 antikoerper, Akap7 antikoerper

Hintergrund: AKAP7 is a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartments. AKAPs have a common RII-binding domain, but contain different targeting motifs responsible for directing PKA to distinct intracellular locations. Three alternatively spliced transcript variants encoding different isoforms have been described. Additional variants exist, but their full-length natures have not been determined.

Molekulargewicht: 11 kDa (MW of target protein)