AKAP7 Antikörper
-
- Target Alle AKAP7 Antikörper anzeigen
- AKAP7 (A Kinase (PRKA) Anchor Protein 7 (AKAP7))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser AKAP7 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- AKAP7 antibody was raised using a synthetic peptide corresponding to a region with amino acids MGQLCCFPFSRDEGKISELESSSSAVLQRYSKDIPSWSSGEKNGGEPDDA
- Top Product
- Discover our top product AKAP7 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
AKAP7 Blocking Peptide, catalog no. 33R-6062, is also available for use as a blocking control in assays to test for specificity of this AKAP7 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AKAP7 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- AKAP7 (A Kinase (PRKA) Anchor Protein 7 (AKAP7))
- Andere Bezeichnung
- AKAP7 (AKAP7 Produkte)
- Synonyme
- akap15 antikoerper, akap18 antikoerper, MGC83920 antikoerper, AKAP7 antikoerper, AKAP15 antikoerper, AKAP18 antikoerper, 6430401D08 antikoerper, AI662165 antikoerper, Akap18 antikoerper, BB170514 antikoerper, AKAP-18 antikoerper, AKAP18d antikoerper, Akap15 antikoerper, A-kinase anchoring protein 7 antikoerper, A-kinase anchoring protein 7 L homeolog antikoerper, A kinase (PRKA) anchor protein 7 antikoerper, AKAP7 antikoerper, akap7.L antikoerper, akap7 antikoerper, Akap7 antikoerper
- Hintergrund
- AKAP7 is a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartments. AKAPs have a common RII-binding domain, but contain different targeting motifs responsible for directing PKA to distinct intracellular locations. Three alternatively spliced transcript variants encoding different isoforms have been described. Additional variants exist, but their full-length natures have not been determined.
- Molekulargewicht
- 11 kDa (MW of target protein)
-