LANCL2 Antikörper

Produktnummer ABIN631238

Produktdetails anti-LANCL2 Antikörper

Target: LANCL2 (LanC like 2 (LANCL2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LANCL2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: LANCL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EMVKPSIDYVRHKKFRSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LANCL2 Blocking Peptide, catalog no. 33R-2598, is also available for use as a blocking control in assays to test for specificity of this LANCL2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LANCL2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LANCL2

Target: LANCL2 (LanC like 2 (LANCL2))

Andere Bezeichnung: LANCL2 (LANCL2 Produkte)

Synonyme: 1700003F10Rik antikoerper, GPR69B antikoerper, TASP antikoerper, LanC (bacterial lantibiotic synthetase component C)-like 2 antikoerper, LanC like 2 antikoerper, Lancl2 antikoerper, LANCL2 antikoerper

Hintergrund: LANCL2 is necessary for abscisic acid (ABA) binding on the cell membrane and activation of the ABA signaling pathway in granulocytes.

Molekulargewicht: 51 kDa (MW of target protein)