MPP2 Antikörper

Produktnummer ABIN631237

Produktdetails anti-MPP2 Antikörper

Target: MPP2 (Membrane Protein, Palmitoylated 2 (MAGUK P55 Subfamily Member 2) (MPP2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MPP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: MPP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QGVGRRSLKNKLIMWDPDRYGTTVPYTSRRPKDSEREGQGYSFVSRGEME

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MPP2 Blocking Peptide, catalog no. 33R-7575, is also available for use as a blocking control in assays to test for specificity of this MPP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MPP2

Target: MPP2 (Membrane Protein, Palmitoylated 2 (MAGUK P55 Subfamily Member 2) (MPP2))

Andere Bezeichnung: MPP2 (MPP2 Produkte)

Synonyme: D11Bwg0652e antikoerper, Dlg2 antikoerper, Dlgh2 antikoerper, Pals4 antikoerper, DLG2 antikoerper, zgc:171280 antikoerper, mpp2 antikoerper, zgc:92011 antikoerper, membrane protein, palmitoylated 2 (MAGUK p55 subfamily member 2) antikoerper, membrane palmitoylated protein 2 antikoerper, membrane protein, palmitoylated 2a (MAGUK p55 subfamily member 2) antikoerper, membrane protein, palmitoylated 2 S homeolog antikoerper, membrane protein, palmitoylated 2b (MAGUK p55 subfamily member 2) antikoerper, Mpp2 antikoerper, MPP2 antikoerper, mpp2a antikoerper, mpp2.S antikoerper, mpp2b antikoerper

Hintergrund: Palmitoylated membrane protein 2 is a member of a family of membrane-associated proteins termed MAGUKs (membrane-associated guanylate kinase homologs).

Molekulargewicht: 61 kDa (MW of target protein)