PPL Antikörper (Middle Region)

Produktnummer ABIN631225

Produktdetails anti-PPL Antikörper

Target: PPL (Periplakin (PPL))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PPL Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Periplakin antibody was raised against the middle region of PPL

Aufreinigung: Affinity purified

Immunogen: Periplakin antibody was raised using the middle region of PPL corresponding to a region with amino acids EKSRAQEKVTEKEVVKLQNDPQLEAEYQQLQEDHQRQDQLREKQEEELSF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Periplakin Blocking Peptide, catalog no. 33R-2523, is also available for use as a blocking control in assays to test for specificity of this Periplakin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPL antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PPL

Target: PPL (Periplakin (PPL))

Andere Bezeichnung: Periplakin (PPL Produkte)

Synonyme: cb180 antikoerper, sb:cb180 antikoerper, im:7140067 antikoerper, im:7149519 antikoerper, AW553870 antikoerper, periplakin antikoerper, periplakin L homeolog antikoerper, PPL antikoerper, ppl antikoerper, ppl.L antikoerper, Ppl antikoerper

Hintergrund: PPL is a component of desmosomes and of the epidermal cornified envelope in keratinocytes. The N-terminal domain of this protein interacts with the plasma membrane and its C-terminus interacts with intermediate filaments. Through its rod domain, this protein forms complexes with envoplakin. This protein may serve as a link between the cornified envelope and desmosomes as well as intermediate filaments. AKT1/PKB, a protein kinase mediating a variety of cell growth and survival signaling processes, is reported to interact with this protein, suggesting a possible role for this protein as a localization signal in AKT1-mediated signaling.

Molekulargewicht: 205 kDa (MW of target protein)