PPL Antikörper (Middle Region)
-
- Target Alle PPL Antikörper anzeigen
- PPL (Periplakin (PPL))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PPL Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Periplakin antibody was raised against the middle region of PPL
- Aufreinigung
- Affinity purified
- Immunogen
- Periplakin antibody was raised using the middle region of PPL corresponding to a region with amino acids EKSRAQEKVTEKEVVKLQNDPQLEAEYQQLQEDHQRQDQLREKQEEELSF
- Top Product
- Discover our top product PPL Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Periplakin Blocking Peptide, catalog no. 33R-2523, is also available for use as a blocking control in assays to test for specificity of this Periplakin antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPL antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PPL (Periplakin (PPL))
- Andere Bezeichnung
- Periplakin (PPL Produkte)
- Synonyme
- cb180 antikoerper, sb:cb180 antikoerper, im:7140067 antikoerper, im:7149519 antikoerper, AW553870 antikoerper, periplakin antikoerper, periplakin L homeolog antikoerper, PPL antikoerper, ppl antikoerper, ppl.L antikoerper, Ppl antikoerper
- Hintergrund
- PPL is a component of desmosomes and of the epidermal cornified envelope in keratinocytes. The N-terminal domain of this protein interacts with the plasma membrane and its C-terminus interacts with intermediate filaments. Through its rod domain, this protein forms complexes with envoplakin. This protein may serve as a link between the cornified envelope and desmosomes as well as intermediate filaments. AKT1/PKB, a protein kinase mediating a variety of cell growth and survival signaling processes, is reported to interact with this protein, suggesting a possible role for this protein as a localization signal in AKT1-mediated signaling.
- Molekulargewicht
- 205 kDa (MW of target protein)
-