Mahogunin RING Finger Protein 1 Antikörper (Middle Region)

Produktnummer ABIN631214

Produktdetails anti-Mahogunin RING Finger Protein 1 Antikörper

Target: Mahogunin RING Finger Protein 1 (MGRN1) (Mahogunin, Ring Finger 1 (MGRN1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Mahogunin RING Finger Protein 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MGRN1 antibody was raised against the middle region of MGRN1

Aufreinigung: Affinity purified

Immunogen: MGRN1 antibody was raised using the middle region of MGRN1 corresponding to a region with amino acids EIYGIENKNNQETKPSDDENSDNSNECVVCLSDLRDTLILPCRHLCLCTS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MGRN1 Blocking Peptide, catalog no. 33R-2492, is also available for use as a blocking control in assays to test for specificity of this MGRN1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGRN1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Mahogunin RING Finger Protein 1

Target: Mahogunin RING Finger Protein 1 (MGRN1) (Mahogunin, Ring Finger 1 (MGRN1))

Andere Bezeichnung: MGRN1 (MGRN1 Produkte)

Synonyme: RNF156 antikoerper, 2610042J20Rik antikoerper, mKIAA0544 antikoerper, md antikoerper, nc antikoerper, RGD1311862 antikoerper, mgrn1 antikoerper, wu:fi38c03 antikoerper, zgc:55978 antikoerper, mahogunin ring finger 1 antikoerper, mahogunin, ring finger 1 antikoerper, mahogunin ring finger 1, E3 ubiquitin protein ligase S homeolog antikoerper, mahogunin ring finger 1, E3 ubiquitin protein ligase antikoerper, mahogunin, ring finger 1a antikoerper, MGRN1 antikoerper, Mgrn1 antikoerper, mgrn1.S antikoerper, mgrn1 antikoerper, mgrn1a antikoerper

Hintergrund: Mahogunin (MGRN1) is a C3HC4 RING-containing protein with E3 ubiquitin ligase activity in vitro.Mahogunin (MGRN1) is a C3HC4 RING-containing protein with E3 ubiquitin ligase activity in vitro.

Molekulargewicht: 63 kDa (MW of target protein)

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling