GSTK1 Antikörper (N-Term)
-
- Target Alle GSTK1 Antikörper anzeigen
- GSTK1 (Glutathione S-Transferase kappa 1 (GSTK1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GSTK1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GSTK1 antibody was raised against the N terminal of GSTK1
- Aufreinigung
- Affinity purified
- Immunogen
- GSTK1 antibody was raised using the N terminal of GSTK1 corresponding to a region with amino acids NLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPK
- Top Product
- Discover our top product GSTK1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GSTK1 Blocking Peptide, catalog no. 33R-6769, is also available for use as a blocking control in assays to test for specificity of this GSTK1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSTK1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GSTK1 (Glutathione S-Transferase kappa 1 (GSTK1))
- Andere Bezeichnung
- GSTK1 (GSTK1 Produkte)
- Synonyme
- gst13-13 antikoerper, GSTK1 antikoerper, gstk1 antikoerper, DKFZp459M1330 antikoerper, GST antikoerper, GST 13-13 antikoerper, GST13 antikoerper, GST13-13 antikoerper, GSTK1-1 antikoerper, hGSTK1 antikoerper, 0610025I19Rik antikoerper, AW260476 antikoerper, DsbA-L antikoerper, GSTkappa antikoerper, glutathione S-transferase kappa 1 L homeolog antikoerper, glutathione S-transferase kappa 1 antikoerper, Glutathione S-transferase kappa 1 antikoerper, gstk1.L antikoerper, GSTK1 antikoerper, gstk1 antikoerper, PTRG_07256 antikoerper, Gstk1 antikoerper, LOC100350399 antikoerper
- Hintergrund
- GSTK1 is a member of the kappa class of the glutathione transferase superfamily of enzymes that function in cellular detoxification. GSTK1 is localized to the peroxisome and catalyzes the conjugation of glutathione to a wide range of hydrophobic substates facilitating the removal of these compounds from cells.
- Molekulargewicht
- 25 kDa (MW of target protein)
-