PYGB Antikörper (N-Term)
-
- Target Alle PYGB (GPBB) Antikörper anzeigen
- PYGB (GPBB) (phosphorylase, Glycogen, Brain (GPBB))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PYGB Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PYGB antibody was raised against the N terminal of PYGB
- Aufreinigung
- Affinity purified
- Immunogen
- PYGB antibody was raised using the N terminal of PYGB corresponding to a region with amino acids ADDWLRYGNPWEKARPEYMLPVHFYGRVEHTPDGVKWLDTQVVLAMPYDT
- Top Product
- Discover our top product GPBB Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PYGB Blocking Peptide, catalog no. 33R-1085, is also available for use as a blocking control in assays to test for specificity of this PYGB antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PYGB antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PYGB (GPBB) (phosphorylase, Glycogen, Brain (GPBB))
- Andere Bezeichnung
- PYGB (GPBB Produkte)
- Synonyme
- GPBB antikoerper, GLYPHOA antikoerper, glycogen phosphorylase B antikoerper, phosphorylase, glycogen; brain antikoerper, brain glycogen phosphorylase antikoerper, phosphorylase, glycogen; brain S homeolog antikoerper, PYGB antikoerper, pygb antikoerper, Pygb antikoerper, pygb.S antikoerper
- Hintergrund
- PYGB is a glycogen phosphorylase found predominantly in the brain. It forms homodimers which can associate into homotetramers, the enzymatically active form of glycogen phosphorylase. The activity of this enzyme is positively regulated by AMP and negatively regulated by ATP, ADP, and glucose-6-phosphate. This enzyme catalyzes the rate-determining step in glycogen degradation.
- Molekulargewicht
- 97 kDa (MW of target protein)
- Pathways
- Cellular Glucan Metabolic Process
-