FABP3 Antikörper

Produktnummer ABIN631167

Produktdetails anti-FABP3 Antikörper

Target: FABP3 (Fatty Acid Binding Protein 3, Muscle and Heart (FABP3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FABP3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: FABP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FABP3 Blocking Peptide, catalog no. 33R-6549, is also available for use as a blocking control in assays to test for specificity of this FABP3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FABP3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FABP3

Target: FABP3 (Fatty Acid Binding Protein 3, Muscle and Heart (FABP3))

Andere Bezeichnung: FABP3 (FABP3 Produkte)

Synonyme: Fabph-1 antikoerper, Fabph-4 antikoerper, Fabph1 antikoerper, Fabph4 antikoerper, H-FABP antikoerper, Mdgi antikoerper, FABP11 antikoerper, M-FABP antikoerper, MDGI antikoerper, O-FABP antikoerper, FABP antikoerper, FABP-3 antikoerper, fabp3 antikoerper, fatty acid binding protein 3 antikoerper, fatty acid binding protein 3, muscle and heart antikoerper, FABP3 antikoerper, Fabp3 antikoerper, fabp3 antikoerper

Hintergrund: The intracellular fatty acid-binding proteins (FABPs) belongs to a multigene family. FABPs are divided into at least three distinct types, namely the hepatic-, intestinal- and cardiac-type. They form 14-15 kDa proteins and are thought to participate in the uptake, intracellular metabolism and/or transport of long-chain fatty acids. They may also be responsible in the modulation of cell growth and proliferation. Fatty acid-binding protein 3 gene contains four exons and its function is to arrest growth of mammary epithelial cells. FABP3 gene is a candidate tumor suppressor gene for human breast cancer.

Molekulargewicht: 15 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process