TKT Antikörper
-
- Target Alle TKT Antikörper anzeigen
- TKT (Transketolase (TKT))
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TKT Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- TKT antibody was raised using a synthetic peptide corresponding to a region with amino acids ESYHKPDQQKLQALKDTANRLRISSIQATTAAGSGHPTSCCSAAEIMAVL
- Top Product
- Discover our top product TKT Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TKT Blocking Peptide, catalog no. 33R-2753, is also available for use as a blocking control in assays to test for specificity of this TKT antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TKT antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TKT (Transketolase (TKT))
- Andere Bezeichnung
- TKT (TKT Produkte)
- Synonyme
- TK antikoerper, TKT1 antikoerper, p68 antikoerper, Dmel\\CG8036 antikoerper, anon-WO0118547.344 antikoerper, cb860 antikoerper, fb38f03 antikoerper, fj52f12 antikoerper, id:ibd3270 antikoerper, wu:cegs2794 antikoerper, wu:fb38f03 antikoerper, wu:fj52f12 antikoerper, tkt1 antikoerper, PSPTO0385 antikoerper, Tb08.11J15.550 antikoerper, xcc-b100_0966 antikoerper, transketolase antikoerper, CG8036 gene product from transcript CG8036-RB antikoerper, TransKeTolase homolog antikoerper, transketolase b antikoerper, transketolase L homeolog antikoerper, transketolase Tkt antikoerper, tkt antikoerper, TKT antikoerper, Tkt antikoerper, CG8036 antikoerper, tkt-1 antikoerper, tktb antikoerper, tkt.L antikoerper, tkt antikoerper, JK_RS05135 antikoerper, Tb927.8.6170 antikoerper, APH_RS01480 antikoerper
- Hintergrund
- TKT belongs to the transketolase family. TKT has been implicated in the latent genetic disease Wernicke-Korsakoff syndrome (WKS), which causes specific brain damage.
- Molekulargewicht
- 68 kDa (MW of target protein)
-