TNNT1 Antikörper
-
- Target Alle TNNT1 Antikörper anzeigen
- TNNT1 (Slow Skeletal Troponin T (TNNT1))
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TNNT1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- Troponin T Type 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids WIHQLESEKFDLMAKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGGRWK
- Top Product
- Discover our top product TNNT1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Troponin T Type 1 Blocking Peptide, catalog no. 33R-9957, is also available for use as a blocking control in assays to test for specificity of this Troponin T Type 1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNNT1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TNNT1 (Slow Skeletal Troponin T (TNNT1))
- Abstract
- TNNT1 Produkte
- Synonyme
- ANM antikoerper, NEM5 antikoerper, STNT antikoerper, TNT antikoerper, TNTS antikoerper, TNNI1 antikoerper, AW146156 antikoerper, Tnt antikoerper, sTnT antikoerper, ssTnT antikoerper, Fang2 antikoerper, tnTs antikoerper, Tnnt antikoerper, zgc:193831 antikoerper, zgc:193865 antikoerper, troponin T1, slow skeletal type antikoerper, troponin I1, slow skeletal type antikoerper, troponin T1, skeletal, slow antikoerper, troponin T1, slow skeletal type S homeolog antikoerper, troponin T type 1 (skeletal, slow) antikoerper, TNNT1 antikoerper, TNNI1 antikoerper, Tnnt1 antikoerper, tnnt1.S antikoerper, tnnt1 antikoerper
- Hintergrund
- TNNT1 is a protein that is a subunit of troponin, which is a regulatory complex located on the thin filament of the sarcomere. This complex regulates striated muscle contraction in response to fluctuations in intracellular calcium concentration. This complex is composed of three subunits: troponin C, which binds calcium, troponin T, which binds tropomyosin, and troponin I, which is an inhibitory subunit. This protein is the slow skeletal troponin T subunit. Mutations in this gene cause nemaline myopathy type 5, also known as Amish nemaline myopathy, a neuromuscular disorder characterized by muscle weakness and rod-shaped, or nemaline, inclusions in skeletal muscle fibers which affects infants, resulting in death due to respiratory insufficiency, usually in the second year.
- Molekulargewicht
- 33 kDa (MW of target protein)
-