SNRK Antikörper (Middle Region)

Produktnummer ABIN631138

Produktdetails anti-SNRK Antikörper

Target: SNRK (SNF Related Kinase (SNRK))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SNRK Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SNRK antibody was raised against the middle region of SNRK

Aufreinigung: Affinity purified

Immunogen: SNRK antibody was raised using the middle region of SNRK corresponding to a region with amino acids SSSETSDDDSESRRRLDKDSGFTYSWHRRDSSEGPPGSEGDGGGQSKPSN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SNRK Blocking Peptide, catalog no. 33R-8848, is also available for use as a blocking control in assays to test for specificity of this SNRK antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRK antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SNRK

Target: SNRK (SNF Related Kinase (SNRK))

Andere Bezeichnung: SNRK (SNRK Produkte)

Synonyme: HSNFRK antikoerper, 2010012F07Rik antikoerper, AI448042 antikoerper, AW547029 antikoerper, E030034B15 antikoerper, R74830 antikoerper, mKIAA0096 antikoerper, SNF related kinase antikoerper, SNRK antikoerper, Snrk antikoerper

Hintergrund: SNRK may play a role in hematopoietic cell proliferation or differentiation. SNRK is the potential mediator of neuronal apoptosis.

Molekulargewicht: 84 kDa (MW of target protein)