TAF7L Antikörper
-
- Target Alle TAF7L Antikörper anzeigen
- TAF7L (TAF7-Like RNA Polymerase II, TATA Box Binding Protein (TBP)-Associated Factor, 50kDa (TAF7L))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TAF7L Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- TAF7 L antibody was raised using a synthetic peptide corresponding to a region with amino acids QKQIEKKEKKLHKIQNKAQRQKDLIMKVENLTLKNHFQSVLEQLELQEKQ
- Top Product
- Discover our top product TAF7L Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TAF7L Blocking Peptide, catalog no. 33R-7610, is also available for use as a blocking control in assays to test for specificity of this TAF7L antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TAF0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TAF7L (TAF7-Like RNA Polymerase II, TATA Box Binding Protein (TBP)-Associated Factor, 50kDa (TAF7L))
- Andere Bezeichnung
- TAF7L (TAF7L Produkte)
- Synonyme
- 4933438I11Rik antikoerper, 50kDa antikoerper, Taf2q antikoerper, RGD1564898 antikoerper, CT40 antikoerper, TAF2Q antikoerper, TATA-box binding protein associated factor 7 like antikoerper, TATA-box binding protein associated factor 7-like antikoerper, Taf7l antikoerper, TAF7L antikoerper
- Hintergrund
- TAF7L gene is similar to a mouse gene that encodes a TATA box binding protein-associated factor, and shows testis-specific expression.
- Molekulargewicht
- 51 kDa (MW of target protein)
-