MTCH2 Antikörper
-
- Target Alle MTCH2 Antikörper anzeigen
- MTCH2 (Mitochondrial Carrier 2 (MTCH2))
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MTCH2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- MTCH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TIGRNIFGRQVCQLPGLFSYAQHIASIDGRRGLFTGLTPRLCSGVLGTVV
- Top Product
- Discover our top product MTCH2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MTCH2 Blocking Peptide, catalog no. 33R-9116, is also available for use as a blocking control in assays to test for specificity of this MTCH2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTCH2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MTCH2 (Mitochondrial Carrier 2 (MTCH2))
- Andere Bezeichnung
- MTCH2 (MTCH2 Produkte)
- Synonyme
- MIMP antikoerper, SLC25A50 antikoerper, Hspc032 antikoerper, fi20c06 antikoerper, fj35g12 antikoerper, wu:fi20c06 antikoerper, wu:fj35g12 antikoerper, 2310034D24Rik antikoerper, 4930539J07Rik antikoerper, HSPC032 antikoerper, mitochondrial carrier 2 antikoerper, mitochondrial carrier 2 L homeolog antikoerper, mitochondrial carrier homolog 2 antikoerper, MTCH2 antikoerper, mtch2.L antikoerper, Mtch2 antikoerper, mtch2 antikoerper
- Hintergrund
- MTCH2 belongs to the mitochondrial carrier family. It contains 2 Solcar repeats. The substrate transported is not yet known. It induces mitochondrial depolarization.
- Molekulargewicht
- 33 kDa (MW of target protein)
-