Ferredoxin Reductase Antikörper (Middle Region)

Produktnummer ABIN631105

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch Ferredoxin Reductase in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für Ferredoxin Reductase Antikörper (Middle Region) (ABIN631105)

Target: Ferredoxin Reductase (FDXR)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Ferredoxin Reductase Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Ferredoxin Reductase Antikörper

Bindungsspezifität: Middle Region

Spezifität: FDXR antibody was raised against the middle region of FDXR

Aufreinigung: Affinity purified

Immunogen: FDXR antibody was raised using the middle region of FDXR corresponding to a region with amino acids LDPVDFLGLQDKIKEVPRPRKRLTELLLRTATEKPGPAEAARQASASRAW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FDXR Blocking Peptide, (ABIN940241), is also available for use as a blocking control in assays to test for specificity of this FDXR antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FDXR antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Ferredoxin Reductase

Target: Ferredoxin Reductase (FDXR)

Andere Bezeichnung: FDXR

Hintergrund: FDXR is a mitochondrial flavoprotein that initiates electron transport for cytochromes P450 receiving electrons from NADPH.

Molekulargewicht: 54 kDa (MW of target protein)