Ferredoxin Reductase Antikörper (Middle Region)
-
- Target Alle Ferredoxin Reductase (FDXR) Antikörper anzeigen
- Ferredoxin Reductase (FDXR)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Ferredoxin Reductase Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FDXR antibody was raised against the middle region of FDXR
- Aufreinigung
- Affinity purified
- Immunogen
- FDXR antibody was raised using the middle region of FDXR corresponding to a region with amino acids LDPVDFLGLQDKIKEVPRPRKRLTELLLRTATEKPGPAEAARQASASRAW
- Top Product
- Discover our top product FDXR Primärantikörper
-
anti-Ferredoxin Reductase (FDXR) (AA 252-491) antibody
FDXR Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Ferredoxin Reductase (FDXR) antibodyFDXR Reaktivität: Human, Maus, Ratte IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Ferredoxin Reductase (FDXR) antibodyFDXR Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Ferredoxin Reductase (FDXR) (AA 33-451) antibodyFDXR Reaktivität: Human WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Ferredoxin Reductase (FDXR) antibodyFDXR Reaktivität: Human, Maus, Ratte WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Ferredoxin Reductase (FDXR) (AA 1-491) antibodyFDXR Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-Ferredoxin Reductase (FDXR) (AA 254-303) antibodyFDXR Reaktivität: Human, Maus, Ratte, Schwein, Rind (Kuh), Pferd WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Ferredoxin Reductase (FDXR) (Middle Region) antibodyFDXR Reaktivität: Human, Maus, Ratte, Schwein, Rind (Kuh), Pferd, Hund WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FDXR Blocking Peptide, catalog no. 33R-4855, is also available for use as a blocking control in assays to test for specificity of this FDXR antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FDXR antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Ferredoxin Reductase (FDXR)
- Andere Bezeichnung
- FDXR (FDXR Produkte)
- Synonyme
- AR antikoerper, AdR antikoerper, FDXR antikoerper, PSPTO4024 antikoerper, ADXR antikoerper, fdxr antikoerper, ferredoxin reductase antikoerper, ferredoxin--NADP reductase antikoerper, ferredoxin--NADP reductase Fpr antikoerper, ferredoxin reductase L homeolog antikoerper, FDXR antikoerper, Fdxr antikoerper, fnr-1 antikoerper, fpr antikoerper, SPO2637 antikoerper, fdxr.L antikoerper
- Hintergrund
- FDXR is a mitochondrial flavoprotein that initiates electron transport for cytochromes P450 receiving electrons from NADPH.
- Molekulargewicht
- 54 kDa (MW of target protein)
-
