ACADSB Antikörper (Middle Region)
-
- Target Alle ACADSB Antikörper anzeigen
- ACADSB (Acyl-CoA Dehydrogenase, Short/branched Chain (ACADSB))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ACADSB Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ACADSB antibody was raised against the middle region of ACADSB
- Aufreinigung
- Affinity purified
- Immunogen
- ACADSB antibody was raised using the middle region of ACADSB corresponding to a region with amino acids GLRASSTCPLTFENVKVPEANILGQIGHGYKYAIGSLNEGRIGIAAQMLG
- Top Product
- Discover our top product ACADSB Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ACADSB Blocking Peptide, catalog no. 33R-3416, is also available for use as a blocking control in assays to test for specificity of this ACADSB antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACADSB antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACADSB (Acyl-CoA Dehydrogenase, Short/branched Chain (ACADSB))
- Andere Bezeichnung
- ACADSB (ACADSB Produkte)
- Synonyme
- 2-mebcad antikoerper, acad7 antikoerper, sbcad antikoerper, DDBDRAFT_0185291 antikoerper, DDBDRAFT_0237707 antikoerper, DDB_0185291 antikoerper, DDB_0237707 antikoerper, 2-MEBCAD antikoerper, ACAD7 antikoerper, SBCAD antikoerper, 1300003O09Rik antikoerper, BB066609 antikoerper, acyl-CoA dehydrogenase, short/branched chain antikoerper, acyl-CoA dehydrogenase short/branched chain antikoerper, acyl-coenzyme A dehydrogenase, short/branched chain antikoerper, acyl-CoA dehydrogenase antikoerper, acyl-CoA dehydrogenase, short/branched chain L homeolog antikoerper, acyl-Coenzyme A dehydrogenase, short/branched chain antikoerper, ACADSB antikoerper, acadsb antikoerper, sce1166 antikoerper, acadsb.L antikoerper, Acadsb antikoerper
- Hintergrund
- Short/branched chain acyl-CoA dehydrogenase(ACADSB) is a member of the acyl-CoA dehydrogenase family of enzymes that catalyze the dehydrogenation of acyl-CoA derivatives in the metabolism of fatty acids or branch chained amino acids. Substrate specificity is the primary characteristic used to define members of this gene family. ACADSB has the greatest activity towards the short branched chain acyl-CoA derivative, (S)-2-methylbutyryl-CoA, but also reacts significantly with other 2-methyl branched chain substrates and with short straight chain acyl-CoAs.
- Molekulargewicht
- 44 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-